Send Message
Home ProductsPeptides Ingredients

High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier

High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier

    • High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
    • High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
    • High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
    • High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier
  • High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier

    Product Details:

    Place of Origin: China
    Brand Name: Youngshe
    Certification: MSDS, TDS, COA
    Model Number: high quality

    Payment & Shipping Terms:

    Minimum Order Quantity: 100mg
    Price: USD300-5000
    Packaging Details: 1g/bottle or customized
    Delivery Time: 3-5 working days
    Payment Terms: L/C, T/T, Western Union, MoneyGram
    Supply Ability: 300G/MONTH
    Contact Now
    Detailed Product Description
    Other Name: Sermorelin Acetate Color: White
    Shelf Lfie: Two Years

    Sermorelin Acetate

     

     

     

    Name: Sermorelin Acetate
    Cas No: 86168-78-7(net),114466-38-5(acetate)
    Formula: C151H250N44O44S
    Molecular:3417
    Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ
    Purity:98%
    Appearance: white powder
    Source: synthetic
    Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

     

    High pure Sermorelin Acetate white color powder with fast delivery from Chinese reliable supplier

     

    Others:

    Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW

    Delivery time : Around 3-5 working days after your payment.

    In stock: Yes

    Capacity: bulk

    Reference price: please inquiry

    Sample: please inquiry

    Guarantee: Full refund if you met any quality problem

    Packing Detail: 1g/bottle or according to your request

    Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius

    Shelf Life: Two years

     

     

     

    Other peptide APIs we have:

     

     

    GHRP-6 Acetate

    GHRP-2 Acetate

    Ipamorelin

    Hexarelin

    MGF

    Melanotan2

    PT141

    CJC-1295

    Semax

    Acetyl Semax

    Acetyl Semax Amide

    Selank

    Acetyl Selank Amide

    Epithalon

    BPC157 peptide

     

     

     

    Order process

    1. Send us your request

    2.Confirm price,delivery time,payment term,your request and all details you care

    3.Sign contract and issue invoice

    4.Payment by your side

    5.We arrange shipment immediately after confirm payment

    6.Delivery( door to door,around 5 working days)

    7.Follow-up service

     

    Packing

    1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.

     

     

     

    Courier

    We will use your favorite courier,such as DHL,UPS,TNT,FEDEX  or EMS. Shipping by Air is also available.

     

    We also have other peptides for hot sale:

    ---------------------------------------------------------------------------------
    Botulinum Toxin like-Inhibiting muscle contraction and smoothing wrinkles:

     

    1. Acetyl Hexapeptide-8 (Argireline)
    2. Acetyl Octapeptide-3 (SNAP-8)
    3. Pentapeptide-18 (Leuphasyl)
    4. Pentapeptide-3 (Vialox)
    5. Dipeptide Diaminobutyroyl Benzylamide Diacetate (SYN-AKE)
    6. Acetyl Hexapeptide-30 (Inyline)
    --------------------------------------------------------------------------------
    Matrix rebuild, Improve skin tone,firmness,thickness,hydration,softness,suppleness and elasticity:

     

    1. Tetrapeptide-21 (TEGO Pep4-17)
    2. Acetyl Tetrapeptide-9 (Dermican)
    3. Palmitoyl Pentapeptide-3 (Matrixyl)
    4. Palmitoyl Oligopeptide+Palmitoyl Tetrapeptide-7 (Matrixyl3000)
    5. Palmtoyl Tripeptide-38 (Matrixyl synthe6)
    6. Palmitoyl Hexapeptide-12 (Biopeptide EL)
    7. Caprooyl Tetrapeptide-3 (Chronoline)
    8. Myristoyl Hexapeptide-4 (sympeptide230)
    9. Acetyl Hexapeptide-37 (Diffuporine)
    10. Palmitoyl Tripeptide-5 (SYN-Coll)
    11. Palmitoyl Dipeptide-5 (SYN-tacks)
    12. Acetyl Tetrapeptide-2 (Uplevity)
    13. Myristoyl Hexapeptide-4 (sympeptide)
    14. Hexapeptide-10 (Serilesine)
    15. Acetyl Dipeptide-13 DIPHENYLGLYCINE (Relistase)
    16. Palmitoyl Oligopeptide (Biopeptide CL)
    17. Palmitoyl Tetrapeptide-3 (Rigin)
    18. Trifluoroacetyl Tripeptide-2 (Progeline)
    19. Trippetide-10 Citrulline (Decorinyl)
    20. Hexapeptide-9 (Collaxyl)
     
    instant ageless Acetyl Hexapeptide 3 Argireline with reship policy from Youngshe Chem

     

    Contact Details
    Chengdu YoungShe Chemical Co., Ltd

    Contact Person: Cecilia

    Tel: +8618108235634

    Send your inquiry directly to us (0 / 3000)