Place of Origin: | China |
Brand Name: | Youngshe |
Certification: | MSDS, TDS, COA |
Model Number: | high quality |
Minimum Order Quantity: | 100mg |
---|---|
Price: | USD300-5000 |
Packaging Details: | 1g/bottle or customized |
Delivery Time: | 3-5 working days |
Payment Terms: | L/C, T/T, Western Union, MoneyGram |
Supply Ability: | 300G/MONTH |
Other Name: | Sermorelin Acetate | Color: | White |
---|---|---|---|
Shelf Lfie: | Two Years |
Sermorelin Acetate
Name: Sermorelin Acetate |
Cas No: 86168-78-7(net),114466-38-5(acetate) |
Formula: C151H250N44O44S |
Molecular:3417 |
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ |
Purity:98% |
Appearance: white powder |
Source: synthetic |
Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French]. |
Others:
Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW
Delivery time : Around 3-5 working days after your payment.
In stock: Yes
Capacity: bulk
Reference price: please inquiry
Sample: please inquiry
Guarantee: Full refund if you met any quality problem
Packing Detail: 1g/bottle or according to your request
Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius
Shelf Life: Two years
Other peptide APIs we have:
GHRP-6 Acetate
GHRP-2 Acetate
Ipamorelin
Hexarelin
MGF
Melanotan2
PT141
CJC-1295
Semax
Acetyl Semax
Acetyl Semax Amide
Selank
Acetyl Selank Amide
Epithalon
BPC157 peptide
1. Send us your request
2.Confirm price,delivery time,payment term,your request and all details you care
3.Sign contract and issue invoice
4.Payment by your side
5.We arrange shipment immediately after confirm payment
6.Delivery( door to door,around 5 working days)
7.Follow-up service
1 gram per bottle(plastic bottle or glass bottle) or customized, protected by bubble film and sealed in a carton/bag.
We will use your favorite courier,such as DHL,UPS,TNT,FEDEX or EMS. Shipping by Air is also available.
We also have other peptides for hot sale: